PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen11g027460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 410aa    MW: 46562.9 Da    PI: 8.6745
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen11g027460.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.81e-49401661128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                       + pGfrF Ptdeel+++yLkkkveg++  + evi+ev+i k+ePwdLp k++ ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v
  Sopen11g027460.1  40 MFPGFRFCPTDEELISYYLKKKVEGSDKCV-EVISEVEIWKHEPWDLPgKSIVQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERNV 131
                       579************************777.99***************878888999************************************ PP

               NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +s +++ +g+k+tLvf+ grapkg++t+W+mhey +
  Sopen11g027460.1 132 KS-GTNIIGTKRTLVFHIGRAPKGQRTQWIMHEYCM 166
                       **.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5637183IPR003441NAC domain
PROSITE profilePS5100553.67940184IPR003441NAC domain
PfamPF023659.1E-2742165IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MEDEDLLGCN SEKKNGEIIE KTKISNSNGV EISVATASTM FPGFRFCPTD EELISYYLKK  60
KVEGSDKCVE VISEVEIWKH EPWDLPGKSI VQSDNEWFFF SPRGRKYPNG SQSKRATESG  120
YWKATGKERN VKSGTNIIGT KRTLVFHIGR APKGQRTQWI MHEYCMTANP LYQDSMVVCR  180
LRKNNEFHLN DTPGNQRNHL AVTNGTVDLS RAVQLNGLGL INGGECCSKE ASSSFSSHSV  240
EQIESGSESD KLNKELPQHH SSSHWKDCDE EDCFADIMKD DIIKLDDSSY KAKHNLLPTI  300
TRKLESSTKS PTSQEAQNPM SNRLPFQGTA NRRLKLQTEK VPRGVERFEL HEANKKNIHA  360
RGISRRFINI TPVKRMKQWS IPLLLISLML LIVLLCLFGV PQQVKWHYSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-44311838164NO APICAL MERISTEM PROTEIN
1ut4_B6e-44311838164NO APICAL MERISTEM PROTEIN
1ut7_A6e-44311838164NO APICAL MERISTEM PROTEIN
1ut7_B6e-44311838164NO APICAL MERISTEM PROTEIN
3swm_A6e-443118311167NAC domain-containing protein 19
3swm_B6e-443118311167NAC domain-containing protein 19
3swm_C6e-443118311167NAC domain-containing protein 19
3swm_D6e-443118311167NAC domain-containing protein 19
3swp_A6e-443118311167NAC domain-containing protein 19
3swp_B6e-443118311167NAC domain-containing protein 19
3swp_C6e-443118311167NAC domain-containing protein 19
3swp_D6e-443118311167NAC domain-containing protein 19
4dul_A6e-44311838164NAC domain-containing protein 19
4dul_B6e-44311838164NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015057146.10.0PREDICTED: NAC domain-containing protein 40-like
TrEMBLK4DA320.0K4DA32_SOLLC; Uncharacterized protein
STRINGSolyc11g068750.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.12e-77NTM1-like 8